Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal DFF40 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DFF40 antibody was raised against a peptide corresponding to 18 amino acids near the center of murine CAD. The immunogen is located within amino acids 130 - 180 of DFF40. |
Rabbit Polyclonal Anti-DFFB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK |
Anti-DFFB Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 146-160 amino acids of human DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase) |
DFFB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DFFB |
DFFB Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 109-338 of human DFFB (NP_004393.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DFFB