Antibodies

View as table Download

Rabbit Polyclonal Anti-DGCR8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGCR8 antibody: synthetic peptide directed towards the N terminal of human DGCR8. Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Rabbit anti-DGCR8 polyclonal antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

DGCR8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human DGCR8

DGCR8 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DGCR8.

DGCR8 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human DGCR8