Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal DHX9 Antibody (N-term)
| Applications | WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This DHX9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human DHX9. |
Goat Anti-DHX9 / RHA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TEGRNALIHKSSVNC, from the internal region of the protein sequence according to NP_001348.2. |
Rabbit Polyclonal Anti-DHX9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX9 antibody: synthetic peptide directed towards the N terminal of human DHX9. Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK |
DHX9 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DHX9 |
RNA Helicase A Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human RNA Helicase A |
RNA Helicase A Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DHX9