Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DNAJC2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 233-263aa) of human ZRF1. |
Rabbit Polyclonal Anti-DNAJC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJC2 antibody: synthetic peptide directed towards the C terminal of human DNAJC2. Synthetic peptide located within the following region: EINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAV |
DNAJC2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DNAJC2 |
DNAJC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human DNAJC2 (NP_055192.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DNAJC2