DNAJC2 Rabbit Polyclonal Antibody

CAT#: TA342762

Rabbit Polyclonal Anti-DNAJC2 Antibody

Product Images

WB Suggested Anti-DNAJC2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNAJC2 antibody: synthetic peptide directed towards the C terminal of human DNAJC2. Synthetic peptide located within the following region: EINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C2
• Database Link:
  NP_055192
  Entrez Gene 27000 Human
  UniProt ID Q99543
• Background: This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described.
• Synonyms: MPHOSPH11; MPP11; ZRF1; ZUO1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 92%; Bovine: 86%