Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 28 of 28 results

(reset)

DPH2 Rabbit Polyclonal Antibody

TA340018

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPH2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-DPH2 antibody: synthetic peptide directed towards the N terminal of human DPH2. Synthetic peptide located within the following region: TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA

DPH2 Rabbit Polyclonal Antibody

TA340019

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPH2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-DPH2 antibody: synthetic peptide directed towards the N terminal of human DPH2. Synthetic peptide located within the following region: CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

CF504834

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPH2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4E7]

CF504852

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPH2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4D9]

CF504853

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPH2 mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI3A12]

CF504855

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPH2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI2B12]

CF504856

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DPH2 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Rabbit Polyclonal Antibody

TA375592

USD 220.00

3 Weeks

DPH2 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 120-330 of human DPH2 (NP_001375.2).
Modifications	Unmodified

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

TA504834

USD 379.00

In Stock

DPH2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]

TA504834AM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 1A12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DPH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A12]

TA504834BM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 1A12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

TA504834S

USD 159.00

2 Days

DPH2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4E7]

TA504852

USD 379.00

In Stock

DPH2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E7]

TA504852AM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 4E7, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DPH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E7]

TA504852BM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 4E7, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4E7]

TA504852S

USD 159.00

2 Days

DPH2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4D9]

TA504853

USD 379.00

In Stock

DPH2 mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D9]

TA504853AM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 4D9, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

DPH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D9]

TA504853BM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 4D9, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI4D9]

TA504853S

USD 159.00

2 Days

DPH2 mouse monoclonal antibody, clone OTI4D9 (formerly 4D9)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI3A12]

TA504855

USD 379.00

In Stock

DPH2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]

TA504855AM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 3A12, Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A12]

TA504855BM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 3A12, HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI3A12]

TA504855S

USD 159.00

2 Days

DPH2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504856

USD 379.00

In Stock

DPH2 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B12]

TA504856AM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 2B12, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B12]

TA504856BM

USD 420.00

5 Days

DPH2 mouse monoclonal antibody,clone 2B12, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

DPH2 Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504856S

USD 159.00

2 Days

DPH2 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

1 - 28 of 28 results