Antibodies

View as table Download

Rabbit Polyclonal Anti-EAF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD

EAF2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human EAF2 (NP_060926.2).
Modifications Unmodified