EAF2 Rabbit Polyclonal Antibody
Other products for "EAF2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | ELL associated factor 2 |
Database Link | |
Background | EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo. |
Synonyms | BM040; TRAITS; U19 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.