Rabbit Polyclonal Anti-EIF3EIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3EIP antibody: synthetic peptide directed towards the N terminal of human EIF3EIP. Synthetic peptide located within the following region: SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV |
Rabbit Polyclonal Anti-IF3EI Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IF3EI Antibody: A synthesized peptide derived from human IF3EI |
EIF3L Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human EIF3L (NP_057175.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
