IF3EI (EIF3L) Rabbit Polyclonal Antibody

CAT#: TA346622

Rabbit Polyclonal Anti-EIF3EIP Antibody

Product Images

WB Suggested Anti-EIF3EIP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3EIP antibody: synthetic peptide directed towards the N terminal of human EIF3EIP. Synthetic peptide located within the following region: SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit L
• Database Link:
  NP_057175
  Entrez Gene 51386 Human
  UniProt ID Q9Y262
• Background: EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
• Synonyms: EIF3EIP; EIF3S6IP; EIF3S11; HSPC021; HSPC025; MSTP005
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%