Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-Laforin (isoform a) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EATGHTNEMKHTTD, from the internal region of the protein sequence according to NP_005661.1. |
Rabbit Polyclonal Anti-EPM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG |
EPM2A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPM2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EPM2A |
EPM2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 244-331 of human EPM2A (NP_005661.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPM2A