Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DCI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCI antibody: synthetic peptide directed towards the N terminal of human DCI. Synthetic peptide located within the following region: ALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEP |
Rabbit Polyclonal Anti-DCI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DCI antibody is: synthetic peptide directed towards the C-terminal region of Human DCI. Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ |
DCI (ECI1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | conjugated synthetic peptide selected from the C-term region of human DCI |
Anti-ECI1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 240 amino acids of human enoyl-CoA delta isomerase 1 |
ECI1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ECI1 |
Active filters
Target Symbol
- ECI1