Antibodies

View as table Download

ECI1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ECI1

Rabbit Polyclonal Anti-DCI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCI antibody: synthetic peptide directed towards the N terminal of human DCI. Synthetic peptide located within the following region: ALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEP

Rabbit Polyclonal Anti-DCI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DCI antibody is: synthetic peptide directed towards the C-terminal region of Human DCI. Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ

DCI (ECI1) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen conjugated synthetic peptide selected from the C-term region of human DCI

Anti-ECI1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 240 amino acids of human enoyl-CoA delta isomerase 1

ECI1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ECI1

ECI1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ECI1