Eci1 Rabbit Polyclonal Antibody

CAT#: TA346704

Rabbit Polyclonal Anti-DCI Antibody

Product Images

Host: Rabbit; Target Name: DCI; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DCI antibody is: synthetic peptide directed towards the C-terminal region of Human DCI. Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: enoyl-CoA delta isomerase 1
• Database Link:
  NP_059002
  Entrez Gene 1632 Human
• Background: catalyzes the interconversion of 3-cis-dodecenoyl-CoA and 2-trans-dodecenoyl-CoA in fatty acid beta oxidation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BC078705.1, D00729.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160522, ERS240727 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
• Synonyms: Dci; eci
• Note: Immunogen Sequence Homology: Human: 100%