Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal EGLN1/PHD2 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Negative), Rat (Negative) |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 1 and 50 of human PHD2/HIF Prolyl Hydroxylase 2 using the numbering given in entry NP_071334.1 (GeneID 54583). |
Rabbit Polyclonal Anti-EGLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN1 antibody: synthetic peptide directed towards the C terminal of human EGLN1. Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
Anti-EGLN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 126 amino acids of human egl nine homolog 1 (C. elegans) |
Rabbit Polyclonal Anti-EGLN1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EGLN1 |
EGLN1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EGLN1 |
PHD2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-426 of human PHD2 (NP_071334.1). |
| Modifications | Unmodified |
EGLN1/EGLN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human EGLN1/EGLN2 |
| Modifications | Unmodified |
Active filters
Target Symbol
- EGLN1