Antibodies

Jump to Filters
View as table Download
PCID1 (EIF3M) Rabbit Polyclonal Antibody
TA346606

USD 410.00

5 Days

Rabbit Polyclonal Anti-EIF3M Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3M antibody: synthetic peptide directed towards the N terminal of human EIF3M. Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
PCID1 (EIF3M) Goat Polyclonal Antibody
TA303063

USD 375.00

5 Days

Goat Polyclonal Antibody against EIF3M

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NAWKQNLNKVKN, from the C Terminus of the protein sequence according to NP_006351.2.
PCID1 (EIF3M) Rabbit Polyclonal Antibody
TA375818

USD 220.00

3 Weeks

EIF3M Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-374 of human EIF3M (NP_006351.2).
Modifications Unmodified