Antibodies

Jump to Filters
View as table Download
ENPP6 Rabbit Polyclonal Antibody
TA337843

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENPP6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENPP6 antibody: synthetic peptide directed towards the middle region of human ENPP6. Synthetic peptide located within the following region: ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS
ENPP6 Rabbit Polyclonal Antibody
TA322012

USD 345.00

4 Weeks

Anti-ENPP6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 119-419 amino acids of human ectonucleotide pyrophosphatase/phosphodiesterase 6
ENPP6 Rabbit Polyclonal Antibody
TA375907

USD 220.00

3 Weeks

ENPP6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 91-440 of human ENPP6 (NP_699174.1).
Modifications Unmodified