Rabbit Polyclonal Anti-EPS15L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EPS15L1 Antibody is: synthetic peptide directed towards the C-terminal region of Human EPS15L1. Synthetic peptide located within the following region: GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP |
Rabbit Polyclonal Anti-Eps15l1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Eps15l1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eps15l1. Synthetic peptide located within the following region: PFGGDPFKESDPFHSSSSDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFE |
Rabbit Polyclonal Anti-EPS15L1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EPS15L1 |
EPS15L1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EPS15L1 |
EPS15L1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 475-754 of human EPS15L1 (NP_001245304.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China