Rabbit Polyclonal Anti-Erc2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Erc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Erc2. Synthetic peptide located within the following region: TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL |
ERC2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ERC2 |
ERC2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 770-850 of human ERC2 (NP_056391.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China