Erc2 Rabbit Polyclonal Antibody

CAT#: TA337749

Rabbit Polyclonal Anti-Erc2 Antibody

Product Images

Host: Rabbit; Target Name: Erc2; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Erc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Erc2. Synthetic peptide located within the following region: TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: ELKS/RAB6-interacting/CAST family member 2
• Database Link:
  NP_808482
  Entrez Gene 238988 Mouse
  UniProt ID Q6PH08
• Background: Erc2 is rhought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. It seems to act together with BSN and may recruit liprin-alpha proteins to the CAZ.
• Synonyms: CAST; CAST1; ELKSL; KIAA0378; MGC133063; MGC133064; SPBC110; Spc110
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%