Rabbit Polyclonal Anti-ERGIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the N terminal of human ERGIC2. Synthetic peptide located within the following region: MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM |
Rabbit Polyclonal Anti-ERGIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the middle region of human ERGIC2. Synthetic peptide located within the following region: TTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH |
ERGIC2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 334-362 amino acids from the C-terminal region of Human ERGIC2 |
Rabbit Polyclonal Anti-Ergic2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ergic2 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ergic2. Synthetic peptide located within the following region: MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIM |
Rabbit Polyclonal Anti-ERGIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ERGIC2 Antibody: synthetic peptide directed towards the middle region of human ERGIC2. Synthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM |
ERGIC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 55-310 of human ERGIC2 (NP_057654.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China