Germany
Japan
United Kingdom
China
Goat Anti-ETFDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EHDQPAHLTLRD, from the internal region of the protein sequence according to NP_004444.2. |
Antibodies
View as table Download
ETFDH (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ETFDH |
Rabbit Polyclonal Anti-ETFDH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETFDH antibody is: synthetic peptide directed towards the C-terminal region of Human ETFDH. Synthetic peptide located within the following region: KTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFY |
Rabbit Polyclonal Anti-ETFDH Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Etfdh antibody is: synthetic peptide directed towards the middle region of Mouse Etfdh. Synthetic peptide located within the following region: EVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGH |
ETFDH Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ETFD |
ETFDH Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 318-617 of human ETFDH (NP_004444.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ETFDH