ETFDH Rabbit Polyclonal Antibody

CAT#: TA342826

Rabbit Polyclonal Anti-ETFDH Antibody

Product Images

Host: Rabbit; Target Name: Etfdh; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Etfdh antibody is: synthetic peptide directed towards the middle region of Mouse Etfdh. Synthetic peptide located within the following region: EVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: electron transfer flavoprotein dehydrogenase
• Database Link:
  NP_004444
  Entrez Gene 66841 Mouse
  UniProt ID Q16134
• Background: Etfdh accepts electrons from ETF and reduces ubiquinone.
• Synonyms: ETFQO; MADD
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Yeast