Germany
Japan
United Kingdom
China
USD 450.00
2 Weeks
Antibodies
View as table Download
Rabbit polyclonal anti-F2RL2 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human F2RL2. |
Rabbit Polyclonal Anti-F2RL2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | F2RL2 / PAR3 antibody was raised against synthetic 19 amino acid peptide from internal region of human F2RL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey, Bovine, Panda (95%); Gibbon, Dog, Elephant, Pig (89%); Rat, Hamster (84%). |
Rabbit Polyclonal Anti-F2RL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK |
F2RL2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PAR3 |
Active filters
Target Symbol
- F2RL2