Rabbit Polyclonal Anti-FAM166A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM166A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM166A. Synthetic peptide located within the following region: TTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIP |
Rabbit Polyclonal Anti-FAM166A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM166A Antibody is: synthetic peptide directed towards the middle region of Human FAM166A. Synthetic peptide located within the following region: FTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQ |
Germany
Japan
United Kingdom
China