FAM166A Rabbit Polyclonal Antibody

CAT#: TA336200

Rabbit Polyclonal Anti-FAM166A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FAM166A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FAM166A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM166A. Synthetic peptide located within the following region: TTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name family with sequence similarity 166 member A
Background The function of this protein remains unknown.
Synonyms HSD46
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 85%; Bovine: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.