Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Fbxo32 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fbxo32 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF |
Rabbit polyclonal anti-Fbx32/MAFbx/ATR-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 56 of rat Fbx32 |
Goat Anti-FBXO32 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NSKTKTQYFHQEK, from the internal region of the protein sequence according to NP_478136.1. |
Rabbit Polyclonal Anti-FBXO32 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO32 antibody: synthetic peptide directed towards the N terminal of human FBXO32. Synthetic peptide located within the following region: QQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDL |
Anti-FBXO32 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
FBXO32 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FBXO32 |
FBXO32 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FBXO32 |
Fbx32/FBOX32 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 206-355 of human Fbx32/FBOX32 (NP_478136.1). |
| Modifications | Unmodified |
Fbx32/FBOX32 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Fbx32/FBOX32 |
| Modifications | Unmodified |
Active filters
Target Symbol
- FBXO32