Fbxo32 Rabbit Polyclonal Antibody

CAT#: TA338810

Rabbit Polyclonal Anti-Fbxo32 Antibody

Product Images

WB Suggested Anti-Fbxo32 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fbxo32 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: F-box protein 32
• Database Link:
  NP_080622
  Entrez Gene 67731 Mouse
  UniProt ID Q9CPU7
• Background: Fbxo32 is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy.
• Synonyms: Atrogin-1; ATROGIN1; Fbx32; FLJ32424; MAFbx; MGC33610
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 92%; Rabbit: 92%; Zebrafish: 92%; Mouse: 85%