FGF9 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF9 |
FGF9 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF9 |
FGF9 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 38-66 amino acids from the N-terminal region of human FGF9 |
Biotinylated Anti-Murine FGF-9 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine FGF-9 |
Anti-Murine FGF-9 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine FGF-9 |
Rabbit Polyclonal Anti-Fgf9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf9 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Fgf9. Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS |
FGF9 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF9 |
FGF9 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human FGF9 (NP_002001.1). |
| Modifications | Unmodified |