Fgf9 Rabbit Polyclonal Antibody

CAT#: TA335026

Rabbit Polyclonal Anti-Fgf9 Antibody

Product Images

WB Suggested Anti-Fgf9 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fgf9 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Fgf9. Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: fibroblast growth factor 9
• Database Link:
  NP_038546
  Entrez Gene 14180 Mouse
  UniProt ID P54130
• Background: Fgf9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
• Synonyms: FGF-9; GAF; HBFG-9; HBGF-9; MGC119914; MGC119915; SYNS3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%; Guinea pig: 79%