Antibodies

Jump to Filters
View as table Download
FKBP11 (N-term) Rabbit Polyclonal Antibody
AP17378PU-N

USD 450.00

2 Weeks

FKBP11 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human FKBP11
FKBP11 (C-term) Rabbit Polyclonal Antibody
AP18019PU-N

USD 450.00

2 Weeks

FKBP11 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FKBP11
FKBP11 Rabbit Polyclonal Antibody
TA342020

USD 375.00

5 Days

Rabbit Polyclonal Anti-FKBP11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP11 antibody: synthetic peptide directed towards the N terminal of human FKBP11. Synthetic peptide located within the following region: VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV