FKBP11 Rabbit Polyclonal Antibody

CAT#: TA342020

Rabbit Polyclonal Anti-FKBP11 Antibody

Product Images

WB Suggested Anti-FKBP11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FKBP11 antibody: synthetic peptide directed towards the N terminal of human FKBP11. Synthetic peptide located within the following region: VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: FK506 binding protein 11
• Database Link:
  NP_057678
  Entrez Gene 51303 Human
  UniProt ID Q9NYL4
• Background: FKBP11 belongs toThe FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyzeThe folding of proline-containing polypeptides.The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited byThe immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]). [supplied by OMIM, Mar 2008]. Transcript Variant:This variant (1) encodesThe longest isoform (1). ##Evidence-Data-START## Transcript exon combination :: AY358998.1, BC027973.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: FKBP19
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Goat: 83%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane