Germany
Japan
United Kingdom
China
Rabbit anti-FMO3 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FMO3 |
Antibodies
View as table Download
FMO3 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FMO3 |
Rabbit Polyclonal Anti-FMO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG |
Rabbit Polyclonal Anti-FMO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
Rabbit Polyclonal Anti-Fmo3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Fmo3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE |
Carrier-free (BSA/glycerol-free) FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FMO3 mouse monoclonal antibody,clone OTI1G3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FMO3