Rabbit Polyclonal Anti-Fntb Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Fntb antibody is: synthetic peptide directed towards the N-terminal region of Rat Fntb. Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK |
Rabbit polyclonal anti-FNTB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FNTB. |
CHURC1-FNTB (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 11-40 amino acids from the N-terminal region of human FNTB. |
FNTB rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FNTB |
FNTB Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human FNTB (NP_002019.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
