Fntb Rabbit Polyclonal Antibody

CAT#: TA344328

Rabbit Polyclonal Anti-Fntb Antibody - N-terminal region

Product Images

WB Suggested Anti-Fntb Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fntb antibody is: synthetic peptide directed towards the N-terminal region of Rat Fntb. Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: farnesyltransferase, CAAX box, beta
• Database Link:
  NP_742031
  Entrez Gene 64511 Rat
  UniProt ID Q02293
• Background: Fntb is a beta subunit of a transferase enzyme; attaches a farnesyl group to cysteine in ras and other membrane-associated proteins.
• Synonyms: FPTB; FTase-beta; MGC31935
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%