Germany
Japan
United Kingdom
China
Anti-FOXJ2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 485-499 amino acids of Human forkhead box J2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXJ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOXJ2 Antibody: synthetic peptide directed towards the middle region of human FOXJ2. Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY |
FOXJ2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 130-158 amino acids from the N-terminal region of Human FOXJ2 |
Rabbit Polyclonal Anti-FOXJ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOXJ2 Antibody: synthetic peptide directed towards the N terminal of human FOXJ2. Synthetic peptide located within the following region: ASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPN |
Active filters
Target Symbol
- FOXJ2