FOXJ2 Rabbit Polyclonal Antibody

CAT#: TA331861

Rabbit Polyclonal Anti-FOXJ2 Antibody

Product Images

WB Suggested Anti-FOXJ2 Antibody Titration: 2.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FOXJ2 Antibody: synthetic peptide directed towards the middle region of human FOXJ2. Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: forkhead box J2
• Database Link:
  NP_060886
  Entrez Gene 55810 Human
  UniProt ID Q9P0K8
• Background: FOXJ2 is a fork head factor that is expressed in many adult tissues. In the embryo, FOXJ2 expression showed a very early onset during the cleavage stages of preimplantation development. It is capable of activating transcription from promoters containing its sites
• Synonyms: FHX
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Rat: 85%; Mouse: 85%; Rabbit: 85%

Reference Data

• Protein Families: Transcription Factors