Antibodies

Jump to Filters
View as table Download
FXYD7 Rabbit Polyclonal Antibody
TA319936

USD 430.00

5 Days

Rabbit Polyclonal FXYD7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FXYD7 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human FXYD7.
FXYD7 Rabbit Polyclonal Antibody
TA338705

USD 375.00

5 Days

Rabbit Polyclonal Anti-FXYD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD7 antibody: synthetic peptide directed towards the N terminal of human FXYD7. Synthetic peptide located within the following region: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK
FXYD7 Rabbit Polyclonal Antibody
TA376402

USD 220.00

3 Weeks

FXYD7 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human FXYD7 (NP_071289.1).
Modifications Unmodified