Antibodies

View as table Download

FABP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP3

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 22

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 30

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 31

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG

FABP3 mouse monoclonal antibody, clone 10E1

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 25

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 5B5

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3

Mouse monoclonal FAPB3 Antibody(Ascites)

Applications WB
Reactivities Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6A4

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6G1

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI4B11

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI5E4

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI8D12

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI13C11

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI9A9

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI1F8

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2B12

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2G2

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI1H7

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6B3

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI8G5

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6A3

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2F5

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI7C7

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6C9

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11C4

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11B4

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11G4

Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11D7

Anti-FABP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3

FABP3 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse FABP3

FABP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP3

FABP3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1).
Modifications Unmodified

FABP3 mouse monoclonal antibody, clone OTI6A4

FABP3 mouse monoclonal antibody, clone OTI6G1

FABP3 mouse monoclonal antibody, clone OTI4B11

FABP3 mouse monoclonal antibody, clone OTI5E4

FABP3 mouse monoclonal antibody, clone OTI8D12

FABP3 mouse monoclonal antibody, clone OTI8D12