FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
Mouse Monoclonal H-FABP Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal H-FABP Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 30
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 31
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 mouse monoclonal antibody, clone 10E1
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 25
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 5B5
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
Mouse monoclonal FAPB3 Antibody(Ascites)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6A4
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6G1
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI4B11
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI5E4
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI8D12
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI13C11
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI9A9
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI1F8
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2B12
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2G2
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI1H7
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6B3
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI8G5
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6A3
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI2F5
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI7C7
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI6C9
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11C4
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11B4
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11G4
Carrier-free (BSA/glycerol-free) FABP3 mouse monoclonal antibody, clone OTI11D7
Anti-FABP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3 |
FABP3 Antibody - N-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse FABP3 |
FABP3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP3 |
FABP3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1). |
Modifications | Unmodified |
FABP3 mouse monoclonal antibody, clone OTI6A4
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
FABP3 mouse monoclonal antibody, clone OTI6A4
FABP3 mouse monoclonal antibody, clone OTI6G1
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
FABP3 mouse monoclonal antibody, clone OTI6G1
FABP3 mouse monoclonal antibody, clone OTI4B11
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
FABP3 mouse monoclonal antibody, clone OTI4B11
FABP3 mouse monoclonal antibody, clone OTI5E4
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
FABP3 mouse monoclonal antibody, clone OTI5E4
FABP3 mouse monoclonal antibody, clone OTI8D12
FABP3 mouse monoclonal antibody, clone OTI8D12
FABP3 mouse monoclonal antibody, clone OTI13C11
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".