Antibodies

Jump to Filters
View as table Download
FAM126A Rabbit Polyclonal Antibody
TA309044

USD 415.00

5 Days

Rabbit Polyclonal antibody to FAM126A (family with sequence similarity 126, member A)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 178 and 446 of FAM126A (Uniprot ID#Q9BYI3)
FAM126A Rabbit Polyclonal Antibody
TA342889

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM126A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM126A antibody: synthetic peptide directed towards the C terminal of human FAM126A. Synthetic peptide located within the following region: MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG