Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against FBG3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing residues 103-119 EWKVEDLSRDQRKEFPN) of the human FBG3 protein. |
Antibodies
View as table Download
Goat Anti-FBXO44 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AALTPPEPPSAEP, from the C Terminus of the protein sequence according to NP_904319.1. |
Rabbit Polyclonal Anti-FBXO44 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO44 Antibody is: synthetic peptide directed towards the middle region of Human FBXO44. Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG |
Active filters
Target Symbol
- FBXO44