FBXO44 Rabbit Polyclonal Antibody

CAT#: TA331684

Rabbit Polyclonal Anti-FBXO44 Antibody

Product Images

Host: Rabbit; Target Name: FBXO44; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FBXO44 Antibody is: synthetic peptide directed towards the middle region of Human FBXO44. Synthetic peptide located within the following region: LDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: F-box protein 44
• Database Link:
  NP_149438
  Entrez Gene 93611 Human
  UniProt ID Q9H4M3
• Background: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Four alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene.
• Synonyms: FBG3; FBX6A; FBX30; Fbx44; Fbxo6a
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome