Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FERMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FERMT1 antibody: synthetic peptide directed towards the N terminal of human FERMT1. Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN |
Rabbit Polyclonal Kindlin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Reacts with residues 643-660 (VHEYIGGYIFLSTRSKDQ) of the 77 kDa human URP1 protein. |
Rabbit Polyclonal Anti-FERMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FERMT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FERMT1. Synthetic peptide located within the following region: VIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHK |
FERMT1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FERMT1 |
FERMT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FERMT1 |
Active filters
Target Symbol
- FERMT1