Kindlin (FERMT1) Rabbit Polyclonal Antibody

CAT#: TA344138

Rabbit Polyclonal Anti-FERMT1 Antibody

Product Images

WB Suggested Anti-FERMT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FERMT1 antibody: synthetic peptide directed towards the N terminal of human FERMT1. Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: fermitin family member 1
• Database Link:
  NP_060141
  Entrez Gene 55612 Human
  UniProt ID Q9BQL6
• Background: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
• Synonyms: C20orf42; DTGCU2; KIND1; UNC112A; URP1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Rat: 79%