Antibodies

View as table Download

Rabbit Polyclonal Anti-TTF2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TTF2 Antibody: A synthesized peptide derived from human TTF2

FOXE1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide C-AYPGGIDRFVSAM from the C-terminus of Human FOXE1 (NP_004464.2).

FOXE1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-TTF2 / FOXE1 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TTF2.

Rabbit polyclonal anti-TTF2 / FOXE1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TTF2.

Rabbit Polyclonal anti-FOXE1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXE1 antibody: synthetic peptide directed towards the middle region of human FOXE1. Synthetic peptide located within the following region: APATTTGYQPAGCTGARPANPSAYAAAYAGPDGAYPQGAGSAIFAAAGRL

Rabbit polyclonal Anti-Foxe1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA

Rabbit Polyclonal Anti-FOXE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXE1