Rabbit Polyclonal Anti-TTF2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TTF2 Antibody: A synthesized peptide derived from human TTF2 |
Rabbit Polyclonal Anti-TTF2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TTF2 Antibody: A synthesized peptide derived from human TTF2 |
FOXE1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide C-AYPGGIDRFVSAM from the C-terminus of Human FOXE1 (NP_004464.2). |
FOXE1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-TTF2 / FOXE1 antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TTF2. |
Rabbit polyclonal anti-TTF2 / FOXE1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TTF2. |
Rabbit Polyclonal anti-FOXE1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXE1 antibody: synthetic peptide directed towards the middle region of human FOXE1. Synthetic peptide located within the following region: APATTTGYQPAGCTGARPANPSAYAAAYAGPDGAYPQGAGSAIFAAAGRL |
Rabbit polyclonal Anti-Foxe1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Foxe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA |
Rabbit Polyclonal Anti-FOXE1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXE1 |