Foxe1 Rabbit Polyclonal Antibody

CAT#: TA331434

Rabbit polyclonal Anti-Foxe1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Foxe1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Foxe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name forkhead box E1
Background Foxe1 is a probable transcription factor. Foxe1 could be involved in thyroid gland organogenesis.
Synonyms FKHL15; FOXE2; HFKH4; HFKL5; TITF2; TTF-2; TTF2
Note Rat: 100%; Mouse: 100%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.