Germany
Japan
United Kingdom
China
Foxe1 Rabbit Polyclonal Antibody
Product Images
Other products for "Foxe1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Foxe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 38 kDa |
| Gene Name | forkhead box E1 |
| Database Link | |
| Background | Foxe1 is a probable transcription factor. Foxe1 could be involved in thyroid gland organogenesis. |
| Synonyms | FKHL15; FOXE2; HFKH4; HFKL5; TITF2; TTF-2; TTF2 |
| Note | Rat: 100%; Mouse: 100%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.