Rabbit Polyclonal Anti-FOXF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXF1 antibody: synthetic peptide directed towards the C terminal of human FOXF1. Synthetic peptide located within the following region: PCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDR |
Rabbit Polyclonal anti-FOXF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXF1 antibody: synthetic peptide directed towards the N terminal of human FOXF1. Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY |
Rabbit Polyclonal Anti-Foxs1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxf1a antibody: synthetic peptide directed towards the middle region of mouse Foxf1a. Synthetic peptide located within the following region: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA |
Goat Anti-FOXF1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HQQVTYQDIKPC, from the C Terminus of the protein sequence according to NP_001442.2. |
Rabbit Polyclonal Anti-Foxs1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXF1A antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALNSGASYIKQQPLSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQ |
Rabbit Polyclonal Anti-FOXF1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FOXF1 |
FOXF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-379 of human FOXF1 (NP_001442.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
