FOXF1 Rabbit Polyclonal Antibody

CAT#: TA342260

Rabbit Polyclonal Anti-Foxs1 Antibody

Product Images

WB Suggested Anti-Foxf1a Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Heart

• 

  Sample Type: Mouse E 18.5 Gut; Dilution: 1:1000

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Foxf1a antibody: synthetic peptide directed towards the middle region of mouse Foxf1a. Synthetic peptide located within the following region: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: forkhead box F1
• Database Link:
  NP_001442
  Entrez Gene 15227 Mouse
  UniProt ID Q12946
• Background: Probable transcription activator for a number of lung-specific genes.
• Synonyms: ACDMPV; FKHL5; FREAC1
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors