Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-FOXJ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXJ1 Antibody: A synthesized peptide derived from human FOXJ1 |
Antibodies
View as table Download
Rabbit polyclonal anti-FOXJ1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXJ1. |
Rabbit Polyclonal Anti-FOXJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXJ1 antibody: synthetic peptide directed towards the N terminal of human FOXJ1. Synthetic peptide located within the following region: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAP |
Rabbit Polyclonal Anti-FOXJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXJ1 antibody: synthetic peptide directed towards the middle region of human FOXJ1. Synthetic peptide located within the following region: LGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFD |
Rabbit Polyclonal Anti-Foxj1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Foxj1 antibody: synthetic peptide directed towards the middle region of mouse Foxj1. Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL |
Anti-FOXJ1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 400-414 amino acids of Human forkhead box J1 |
Foxj1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Active filters
Target Symbol
- FOXJ1