HFH4 (FOXJ1) Rabbit Polyclonal Antibody
Other products for "FOXJ1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Foxj1 antibody: synthetic peptide directed towards the middle region of mouse Foxj1. Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | forkhead box J1 |
Database Link | |
Background | May play an important role in cell fate determination during lung development and in spermatogenesis. |
Synonyms | FKHL13; HFH-4; HFH4 |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 83%; Dog: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.