HFH4 (FOXJ1) Rabbit Polyclonal Antibody

CAT#: TA341771

Rabbit Polyclonal Anti-Foxj1 Antibody

Product Images

WB Suggested Anti-Foxj1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Foxj1 antibody: synthetic peptide directed towards the middle region of mouse Foxj1. Synthetic peptide located within the following region: HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: forkhead box J1
• Database Link:
  NP_001445
  Entrez Gene 15223 Mouse
  UniProt ID Q92949
• Background: May play an important role in cell fate determination during lung development and in spermatogenesis.
• Synonyms: FKHL13; HFH-4; HFH4
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 83%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors