Rabbit Polyclonal Anti-FTHL17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FTHL17 antibody: synthetic peptide directed towards the N terminal of human FTHL17. Synthetic peptide located within the following region: MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR |
Rabbit Polyclonal Anti-FTHL17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FTHL17 antibody: synthetic peptide directed towards the middle region of human FTHL17. Synthetic peptide located within the following region: FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE |
Germany
Japan
United Kingdom
China